SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218904451|ref|YP_002452285.1| from Bacillus cereus AH820

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218904451|ref|YP_002452285.1|
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.000054
Family Surp module (SWAP domain) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218904451|ref|YP_002452285.1|
Sequence length 240
Comment hypothetical protein BCAH820_3335 [Bacillus cereus AH820]
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFVFGMISLLSEWRILLFVAVMIPFFIVNMYYARQKNERALLNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
LLMIIVFAINPWCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences A0A0B5NV88 A0A1N7UQF8 B7JFC3 C2TJ04 C3GLC9
405535.BCAH820_3335 gi|218904451|ref|YP_002452285.1| WP_000779964.1.100059 WP_000779964.1.16013 WP_000779964.1.23615 WP_000779964.1.29804 WP_000779964.1.42217 WP_000779964.1.45919 WP_000779964.1.63137 WP_000779964.1.7545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]