SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218904889|ref|YP_002452723.1| from Bacillus cereus AH820

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218904889|ref|YP_002452723.1|
Domain Number 1 Region: 180-463
Classification Level Classification E-value
Superfamily Subtilisin-like 3.93e-36
Family Subtilases 0.00047
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-32
Family Collagen-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218904889|ref|YP_002452723.1|
Sequence length 613
Comment subtilase family serine protease [Bacillus cereus AH820]
Sequence
MKIFQKMCASTVIITTLLGIGGTVNSVHADSIEQQSKLGIDQETDKQIIVKFKADLKFPY
EDGIEKQIQSQTNDKVLEDLLVEYPDVTFTRLFTSVSPEEIEDLEVKAPNNVSTSLLNYY
ILQTQNGEQKEELVDRLKKSCLIEDVYMKKQEKITPPEVQPSSVSLSPNNNPRFKQQGYL
EAAPYGINVPFAWEVQGGKGSGITFVDMEYGWLLNHEDLVHQNIELMSGINIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGVVIIEAGANGWNDLDQFKDRNGKQILNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNENTGTKSKDPYADQIGVLPD
LKSILVNLGYGQRKPNGGNELQVTENEPNNERIQANKVNFHTPMKGTLHNSDRVDVFTFQ
MDSPENITISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYHAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences B7JJ39
gi|218904889|ref|YP_002452723.1| WP_000689184.1.7545 405535.BCAH820_3772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]