SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|213157710|ref|YP_002320508.1| from Acinetobacter baumannii AB0057

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|213157710|ref|YP_002320508.1|
Domain Number 1 Region: 30-73,106-134
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000108
Family PWWP domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|213157710|ref|YP_002320508.1|
Sequence length 168
Comment hypothetical protein AB57_3189 [Acinetobacter baumannii AB0057]
Sequence
MSTQTIIDNQISAQLEGRTDIRVECLDTSKVFNPKLYAQKKGKTTLYWIQFFGTHHISKA
EYDELIELSESDVFGNLTFKADSEEEFKNKYYAKRPNVILEKVGIALFGKSWKKALADAL
SEIKQVDERRITHWLQCSRPIPKNVFKDLKVIKDKRLKEIQSIEKLLD
Download sequence
Identical sequences A0A0C0BBP5 A0A0J0ZQC9
gi|523528278|ref|YP_008214309.1| 480119.AB57_3189 gi|213157710|ref|YP_002320508.1| WP_000107290.1.100152 WP_000107290.1.100971 WP_000107290.1.101338 WP_000107290.1.101742 WP_000107290.1.10328 WP_000107290.1.10512 WP_000107290.1.1216 WP_000107290.1.13635 WP_000107290.1.1390 WP_000107290.1.14479 WP_000107290.1.14853 WP_000107290.1.14909 WP_000107290.1.14939 WP_000107290.1.15695 WP_000107290.1.16610 WP_000107290.1.16701 WP_000107290.1.16787 WP_000107290.1.17002 WP_000107290.1.1753 WP_000107290.1.20066 WP_000107290.1.21546 WP_000107290.1.23401 WP_000107290.1.24292 WP_000107290.1.24358 WP_000107290.1.2475 WP_000107290.1.25263 WP_000107290.1.25971 WP_000107290.1.26204 WP_000107290.1.26425 WP_000107290.1.2736 WP_000107290.1.27509 WP_000107290.1.28385 WP_000107290.1.28581 WP_000107290.1.28677 WP_000107290.1.29461 WP_000107290.1.29779 WP_000107290.1.29817 WP_000107290.1.30161 WP_000107290.1.30597 WP_000107290.1.31917 WP_000107290.1.3225 WP_000107290.1.32386 WP_000107290.1.32773 WP_000107290.1.33308 WP_000107290.1.34049 WP_000107290.1.36122 WP_000107290.1.36355 WP_000107290.1.36882 WP_000107290.1.3712 WP_000107290.1.37386 WP_000107290.1.37603 WP_000107290.1.38009 WP_000107290.1.38249 WP_000107290.1.3837 WP_000107290.1.3861 WP_000107290.1.39159 WP_000107290.1.39353 WP_000107290.1.39399 WP_000107290.1.40199 WP_000107290.1.41546 WP_000107290.1.41878 WP_000107290.1.42289 WP_000107290.1.43751 WP_000107290.1.43766 WP_000107290.1.44009 WP_000107290.1.44370 WP_000107290.1.44964 WP_000107290.1.46138 WP_000107290.1.46774 WP_000107290.1.46887 WP_000107290.1.4824 WP_000107290.1.48692 WP_000107290.1.48824 WP_000107290.1.49705 WP_000107290.1.50111 WP_000107290.1.50641 WP_000107290.1.51378 WP_000107290.1.51709 WP_000107290.1.52342 WP_000107290.1.53097 WP_000107290.1.53331 WP_000107290.1.53762 WP_000107290.1.5412 WP_000107290.1.54138 WP_000107290.1.54242 WP_000107290.1.54464 WP_000107290.1.54492 WP_000107290.1.55447 WP_000107290.1.55638 WP_000107290.1.56668 WP_000107290.1.5697 WP_000107290.1.58802 WP_000107290.1.59456 WP_000107290.1.59754 WP_000107290.1.59944 WP_000107290.1.62150 WP_000107290.1.6221 WP_000107290.1.62543 WP_000107290.1.62817 WP_000107290.1.63426 WP_000107290.1.63649 WP_000107290.1.63681 WP_000107290.1.64044 WP_000107290.1.64586 WP_000107290.1.65154 WP_000107290.1.66458 WP_000107290.1.66952 WP_000107290.1.67361 WP_000107290.1.67922 WP_000107290.1.68705 WP_000107290.1.68830 WP_000107290.1.68930 WP_000107290.1.69665 WP_000107290.1.69859 WP_000107290.1.69930 WP_000107290.1.70461 WP_000107290.1.70891 WP_000107290.1.71347 WP_000107290.1.72299 WP_000107290.1.72317 WP_000107290.1.74711 WP_000107290.1.74949 WP_000107290.1.75121 WP_000107290.1.75386 WP_000107290.1.75478 WP_000107290.1.75738 WP_000107290.1.75859 WP_000107290.1.76250 WP_000107290.1.7662 WP_000107290.1.77396 WP_000107290.1.77634 WP_000107290.1.77815 WP_000107290.1.7791 WP_000107290.1.78263 WP_000107290.1.79789 WP_000107290.1.79938 WP_000107290.1.80195 WP_000107290.1.80997 WP_000107290.1.82355 WP_000107290.1.82453 WP_000107290.1.82967 WP_000107290.1.83297 WP_000107290.1.83450 WP_000107290.1.85449 WP_000107290.1.86715 WP_000107290.1.87292 WP_000107290.1.87319 WP_000107290.1.879 WP_000107290.1.88040 WP_000107290.1.89289 WP_000107290.1.89643 WP_000107290.1.91998 WP_000107290.1.92687 WP_000107290.1.92711 WP_000107290.1.92830 WP_000107290.1.93437 WP_000107290.1.93485 WP_000107290.1.93778 WP_000107290.1.94012 WP_000107290.1.95001 WP_000107290.1.95923 WP_000107290.1.96747 WP_000107290.1.96998 WP_000107290.1.97163 WP_000107290.1.9832 WP_000107290.1.98523 WP_000107290.1.98692 WP_000107290.1.9952 WP_000107290.1.99770 WP_000107290.1.99825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]