SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330832361|ref|YP_004401186.1| from Streptococcus suis ST3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330832361|ref|YP_004401186.1|
Domain Number 1 Region: 42-431
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.92e-95
Family Amylase, catalytic domain 0.00000000135
Further Details:      
 
Domain Number 2 Region: 605-699
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.37e-30
Family Starch-binding domain 0.0000582
Further Details:      
 
Domain Number 3 Region: 434-521
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.93e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.00011
Further Details:      
 
Domain Number 4 Region: 526-602
Classification Level Classification E-value
Superfamily E set domains 0.000000000000035
Family E-set domains of sugar-utilizing enzymes 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330832361|ref|YP_004401186.1|
Sequence length 710
Comment putative secreted alpha-amylase [Streptococcus suis ST3]
Sequence
MKKFYWKDYLMALPIIILFLITTKFSVINAESYNSINNKVDFSSDVIYQIITDRFYDGDS
TNNPSGEIFDTTNLRKYHGGDWRGIIKKIQDGYLTDLGITAIWISSPVENITSIDPTSNS
ASYHGYWARDFFNTNSAFGTQEDFKELVSIAHENNIKIVIDFAPNHTSTAEYSGYSFPED
GALFRNGNLIGTFSNDVDGIFNHESWTDYSTYENGIYHSLYGLADLNNINPTIDKYLKDA
IVSWIDYGIDGIRVDAVKHMSLGWQKNWLSYIYEKTGIFVFGEWYTGGTEAEVEMTSFAN
NSGMSLLDFRFANAIRNLYSSDTFTMLDFYNVLQATENDYEEINDQVTFIDNHDMSRFST
LVNGNQLAVNQAYALLLTSRGVPTIYYGSEQYDQGGNDPENRSDISSFNKNSNAYKVISK
LSNLRKHNQALAYGTTQERWINSDVLIFERKFASTVALIAVNKGSSSYKIENLYTSLPLG
NYEDQLSGLLYSDSISVDSNGAVASFELSKGEVGVWVYSDENSDISIGNIGPSIGISGNE
VSISGTGFGSEVGQVYFENTLSDIVEWSDTLIKVRVPETPAGIYNVKVLNQSGMETIFSN
FEILTATQVPVRFIVNNAETSYGENVYVVGNVSELGNWNPEKAVGTFFNSTATIAQYPSW
FYDINLPVNTRIEYKFIKKNQSGEVTWESGSNHVLNTSIIADTFIQNWQK
Download sequence
Identical sequences gi|330832361|ref|YP_004401186.1| WP_013730220.1.21217 WP_013730220.1.2991 WP_013730220.1.44378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]