SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325285062|ref|YP_004260852.1| from Cellulophaga lytica DSM 7489

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325285062|ref|YP_004260852.1|
Domain Number 1 Region: 38-248
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.94e-36
Family Endonuclease I 0.0015
Further Details:      
 
Domain Number 2 Region: 1304-1597
Classification Level Classification E-value
Superfamily DNase I-like 1.04e-21
Family DNase I-like 0.038
Further Details:      
 
Domain Number 3 Region: 270-360
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000369
Family Fibronectin type III 0.0000909
Further Details:      
 
Weak hits

Sequence:  gi|325285062|ref|YP_004260852.1|
Domain Number - Region: 884-965
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.00288
Family Lamin A/C globular tail domain 0.016
Further Details:      
 
Domain Number - Region: 598-633
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0471
Family Pre-dockerin domain 0.022
Further Details:      
 
Domain Number - Region: 536-610
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.0667
Family Lamin A/C globular tail domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325285062|ref|YP_004260852.1|
Sequence length 1889
Comment Endonuclease I [Cellulophaga lytica DSM 7489]
Sequence
MMKNYLKVLISIGMLLLTAIGYCQVPAYYNGTDVTQTGGNLKTDLSNLVTTTQTTVLSYT
PGVWDALKQTDLDPANSNNVLLIYGYNDADGNTTTDRTRSKNNNGGGVGDWNREHVFPKS
LGNPNLGTSGPGSDAHHLRSSDVQFNSLRNNHPFGDGSGNAGLMSGNVWYPGDEWKGDVA
RMIMYMYIRYGNQCLPTAVGTGATTYSGDVPDIFLQWNAEDPVSQVEINRNVLLEGIQGN
RNPFIDNPAFATAIWGGPQAENRFNNTSSDTEAPTAPLNLSAANTTETETLLSWDAATDN
VGVTAYQIFNGTTLAGVVSGTSYLVTNLTAETTYTFTIKALDAAGNMSANSNTVTITTLE
DTIVTPPAGDYIISQGYESTATDNWNYTVSPNNCNDGGSDVWDVVTSVGSISTANTGTNF
FGIRDLEGNCGTADGGTLTFDAVDISTYTDVSLSFAVNVVGYDVTNGDTISYEIFHDGTS
QGVQVITVGSPYSTADWEQITTAVPNTVSSVSLRLFVKQNGGSDYAGFDDVRLEGTSSST
PVTPSILINEIDADTPGTDTQEFVELFDGGAGNTPLDGLVMVLYNGSNNQSYAAYDLDGY
TTDANGYFVIGNVDVPNVSLVIPSNGLQNGADAVVIYTGDASDFPNGSSVTTDNIVDAVV
YDTNDSDDLELLVLLNAGEAQVNEGGAGDKDNHSSQRILNGAGGAQNTSTFAQETPTPGA
ANGEVVVVPPTEATILINELDADTAGTDTQEFVELFDGGAGNTALDGKVLVFYNGSNNQS
YAAYDLDGYSTDANGYFVIGNADVPNVNIIIPSNGLQNGADAVALYTGDAADFPNNSAIN
TTNLLDALVYDTNDSDDAELLVLLNAGEAQINEGGAGDKDAHSLQRYTNGSGAALSTANY
VQALPTPGASNTNATEPITLVINEVDADTAGTDTQEFVELFDGGKGNTALDGFVLVHYNG
SNNQSYAAYDLDGYTTNAEGYFVMGNVDVPNVSLVIPSNGLQNGADAVALYTGNASDFQN
VAVTTNGLIDALVYDTNDSDATELLALLNVGEAQINEDELGNKDGHSLQRFPNGQGGARN
TATYTQAIPSPGTENGAVIPPPATISIAEARNVADGEVVTVTGVLTVADAFAGSAYIQDA
TGAIAIFDELVHGEGVFMVGDSITVTGTRSAFNDQLQIATVTNVENNGAPTNAITPVTVT
LSELVNHPAELVRIINPAFPKPGDILFGNSNYTITDASGNGSLRIDNDVEAIVGLGQPNT
CTEITGVVGRFYETYQLLPRSSEDMPCAGEYVPPTIPVEIGKDKTLDVVAWNIEWFGDEA
NSPAAGSPMSDAIQKDSTKAIIAKLDADIYAVEEIADETLFAQMVSELPGYDYVLSPAVS
YPNDPGVSQKLGFIYNTATVNVVNTKVLLQTIHPMYNGGDDSALINYPSATDRFYASGRL
PFLMTADVTINGATEQINVVALHARANSGTDAQGRYDMRKYDVEVLKDTLDVQYADKKLI
LLGDYNDDVDTTVADITTTTTSSFNAYATDEVNYNIVSKTLSDQDFRSYVFRENMIDHIT
ITNELNDNYIAESARVHYEFYDSDYPNTVSDHFPVSARFQLKGLELVSISTTDVTCSTAL
DGTATVVVEGGAKPYAYEWSNGDTTETATSLEAGTHSVIITDALGNEVTEEFIITAPEAI
NISVSDNTKVYLGYDSCTTLSVTTVEGGVAPYSYEWSNGETTQDIKACPEATTTYTVTVT
DANGCFTTANVTVDVEDVRCGNAYRPGVEVCYKGKSYCMSKWAAAVFVKYYGATLGACDA
QDQVSITNLRLYPNPFRNYLNIQLNSNLDTNADFVIYNFYGRKVFSSKEQLTAGKSNLTY
NLSYLRRGKYFLKVRVNGVTQKARLLIKR
Download sequence
Identical sequences F0RG21
gi|325285062|ref|YP_004260852.1| WP_013619729.1.53776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]