SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325285994|ref|YP_004261784.1| from Cellulophaga lytica DSM 7489

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325285994|ref|YP_004261784.1|
Domain Number 1 Region: 266-442
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.89e-39
Family Endonuclease I 0.00052
Further Details:      
 
Weak hits

Sequence:  gi|325285994|ref|YP_004261784.1|
Domain Number - Region: 66-135
Classification Level Classification E-value
Superfamily Cadherin-like 0.0585
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325285994|ref|YP_004261784.1|
Sequence length 459
Comment Endonuclease I [Cellulophaga lytica DSM 7489]
Sequence
MMTKSILNIKKYTYTILLSAITLGCSSSDGGTEQPDPEPTPVNKPIAVDDEVTGIENEEL
IISSLLENDSRIGATITSFDATSTGGATIIENRDGTYTYTPKADFIGVDTFTYTICDTEE
TPNCSTATVTVSIVDEGDPVAIDDAYATVENTATTITTALDNDTIIDDAILTSVDGSGSS
GTVELNSNGEIVYTPQSNFTSNDSFTYTICDNDKPDATCSTATITITIAEKLSFNIPAEL
QEYYSNVAFSNNAEVTLNALKEHTTNKHTTILSYGQRHNYLYNADEDETIADNVILMYSG
ESRDHREYQSGSNSHSPQTFNTEHIFPQSKLGSNIAVSDLHHLRSCDAIVNEDRSNFAYT
NGSGEYKLIDSNKWYPGDDWRGDVARMVLYLNIRYNEDITQVGTMDLFLEWNAADPVSSF
EIQRNNVIEEAQGNRNPFIDNPYLATIVWGGNEAENKWE
Download sequence
Identical sequences F0REV8
gi|325285994|ref|YP_004261784.1| WP_013620661.1.53776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]