SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325287670|ref|YP_004263460.1| from Cellulophaga lytica DSM 7489

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325287670|ref|YP_004263460.1|
Domain Number - Region: 20-64
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0282
Family Recombination endonuclease VII, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325287670|ref|YP_004263460.1|
Sequence length 200
Comment hypothetical protein Celly_2772 [Cellulophaga lytica DSM 7489]
Sequence
MIFYGSNSSQLKSKLTRQIPCANCNESAKFNVEVYGKYAHLYWIPIFPIGKTGGAVCTNC
NTVFEPKQMDHNLKLEYQNVKDEAKTPIRHFSALFIIAILITGLSVSSFLDGKNSEEYIA
HPMVNDLYEFKTEANYYSTMKISSISDSIYFKFNEYETNKKSGISEIDIPKNYEEQEYGY
TTKELQGLFKDNIIYEVKRN
Download sequence
Identical sequences F0RB12
gi|325287670|ref|YP_004263460.1| WP_013622332.1.53776 WP_013622332.1.62073 WP_013622332.1.93229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]