SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|319778416|ref|YP_004129329.1| from Taylorella equigenitalis MCE9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319778416|ref|YP_004129329.1|
Domain Number 1 Region: 2-210
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.62e-35
Family RNA methyltransferase FtsJ 0.0000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319778416|ref|YP_004129329.1|
Sequence length 210
Comment cell division protein FtsJ [Taylorella equigenitalis MCE9]
Sequence
MAKNKFSKNWIHQHINDPYVKLAQQKGYRARAAFKLIEILDAEKLMHRGDIIVDLGSSPG
SWSQVARERLLKNGVIDGRIIALDLLPMEHIEGVEFIQGDFRDETILKALEEKVGFQQVD
LVISDMAPNLSGISSADSARIQHVVELAVEFATNHLKPQGALIVKAFHGSGFSQLIELFK
KNFVRVVEIKPKASRDKSSETFIVGKKLKN
Download sequence
Identical sequences E8UE09
WP_013521422.1.21018 WP_013521422.1.79536 WP_013521422.1.94800 gi|319778416|ref|YP_004129329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]