SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378722200|ref|YP_005287086.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378722200|ref|YP_005287086.1|
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.46e-111
Family G proteins 0.0000000166
Further Details:      
 
Domain Number 2 Region: 481-607
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-38
Family Translational machinery components 0.0000471
Further Details:      
 
Domain Number 3 Region: 264-403
Classification Level Classification E-value
Superfamily Translation proteins 8.33e-35
Family Elongation factors 0.0001
Further Details:      
 
Domain Number 4 Region: 611-695
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.87e-30
Family EF-G/eEF-2 domains III and V 0.0000584
Further Details:      
 
Domain Number 5 Region: 403-480
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 5.76e-24
Family EF-G/eEF-2 domains III and V 0.000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378722200|ref|YP_005287086.1|
Sequence length 699
Comment elongation factor G [Rickettsia rickettsii str. Arizona]
Sequence
MSKINKLEHIRNIGICAHIDAGKTTTTERILYYTGKSHKIGEVHEGGATMDWMEQEQERG
ITITSAATTCRWQDKIINIIDTPGHVDFTIEVERSLRVLDGAVAVFDGVAGVEPQSETVW
RQADKYNVPRMCFVNKMDRMGADFYRCVEMLKDRLGAKPLVIQLPVGIEENFKGIIDLIK
MKAVIWKDEALGAEYFEEDIPADMKDKAEEYRAKLLDMVVELDDHVMEKYLSGEEVTAEE
IKRLIRKGTISAAFYPVLCGSAFKNKGVQPLLDAVVDFLPSPIDIGIVKGMEVSTGEETD
FPISVTEPFAALAFKIMNDPFVGSLTFIRIYSGKITSGTTVINTVKNKREKIGRMLLMHA
NNREDVKEASAGDIVALAGLKDTTTGDTLSDIDQQVILERMEFPEPVIELAVEPKSTADQ
EKMGLALSRLAAEDPSFRVSTDYETGQTVIKGMGELHLEIIIDRMRREFKVEANIGAPQV
AYRETITKVCEIDYTHKKQSGGAGQFARVKIIFEPLKEVKDLKDEDKNKNFVFESKIIGG
AVPKEYIPGVEKGLNNIRETGVIAGYPMIDFKATLVDGAFHDVDSSVLAFEIAAKAAFRE
GMPKGNPKLLEPIMQVEVITPDEYMGDIIGDLNSRRGQIQSMDPRGNAQVVTANVPLAEM
FGYVNTLRSLSQGRAQFSMIFSHYDQVPSQVADIIKAKK
Download sequence
Identical sequences A8GQV7 B0BWA2
gi|157828048|ref|YP_001494290.1| gi|378720847|ref|YP_005285734.1| gi|165932745|ref|YP_001649534.1| 392021.A1G_01000 452659.RrIowa_0215 gi|378722200|ref|YP_005287086.1| gi|379017347|ref|YP_005293581.1| WP_012150391.1.17801 WP_012150391.1.31136 WP_012150391.1.3339 WP_012150391.1.38731 WP_012150391.1.4490 WP_012150391.1.74071 WP_012150391.1.77680 WP_012150391.1.78650 WP_012150391.1.81845 WP_012150391.1.83836 WP_012150391.1.89241 gi|378723559|ref|YP_005288443.1| gi|379016890|ref|YP_005293125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]