SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378722671|ref|YP_005287557.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378722671|ref|YP_005287557.1|
Domain Number 1 Region: 595-770
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.79e-55
Family ATP-dependent protease Lon (La), catalytic domain 0.00000197
Further Details:      
 
Domain Number 2 Region: 313-586
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.59e-47
Family Extended AAA-ATPase domain 0.00033
Further Details:      
 
Domain Number 3 Region: 5-204
Classification Level Classification E-value
Superfamily PUA domain-like 1.02e-23
Family LON domain-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378722671|ref|YP_005287557.1|
Sequence length 778
Comment ATP-dependent protease La [Rickettsia rickettsii str. Arizona]
Sequence
MHKKSLPLMALRDMVVFPGVIAPIFVGRPKSLQALSHTTISEEDNSKYILVTLQKKFDQE
NPSTHELYNTAILAKIIQIVKLPNNTAKILIEAVARVKLSNIKGDEAFEANYEIIPDEEI
FDVNNMRSLVDNAVQLFSKYAINDKKVNAEIIETINKAISNSTNFIDIINILASHLITSL
EAKQHLLEETSPFKRITTVISTLTSNIVNSETEQALQQRVRKQIEKTQRDYYLHEQMKAI
QKELDEDKSELADIEKKIKSLKLSKEAKEKAEAELKKLRTMNQMSAESGVTRNYLETLLS
LPWGKYDNSKIDINQAEKILNRDHFGLEKVKERIIEYLAVLQRSSKIRGPILCLIGPPGV
GKTSLVKSIAEGMGRKYTKLALGGVRDEAEIRGHRKTYLGSMPGKILGQLKKVKTSNPVM
LLDEIDKMSSDFRGDPASALLEVLDPEQNSHFVDHYLEVEYDLSNVIFIATANSHDLPRA
LSDRMEKIYISGYVEETKLQIARNYLVPKQFKMHKIKKDEITISEMALLDLIRYYTKESG
VRALEREIGALTRKALKQILADKSVKHIAIDSNHLEEFLGAKKYNFGLAEKEDQIGSTTG
LAYTEVGGELLTIEALAFPGKGEIKTTGKLGDVMKESAMAAYSCFRSRATNFGLKYDNYK
DFDIHIHVPAGAIPKDGPSAGCALFTTIVSLMTKIPVHRTVAMTGEITLRGNVLPIGGLK
EKLLAASRGGIKTVLIPEENVKDLQDIPPNIKESLEIISVSNIDQVLKHALVGTPINK
Download sequence
Identical sequences gi|378722671|ref|YP_005287557.1| gi|379016422|ref|YP_005292657.1| gi|378724026|ref|YP_005288910.1| WP_014362344.1.17801 WP_014362344.1.31136 WP_014362344.1.3339 WP_014362344.1.38731 WP_014362344.1.4490 WP_014362344.1.74071 WP_014362344.1.77680 WP_014362344.1.78650 WP_014362344.1.81845 WP_014362344.1.83836 WP_014362344.1.89241 gi|379017815|ref|YP_005294050.1| gi|378721320|ref|YP_005286207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]