SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378722843|ref|YP_005287729.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378722843|ref|YP_005287729.1|
Domain Number 1 Region: 61-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.26e-47
Family RecA protein-like (ATPase-domain) 0.0085
Further Details:      
 
Domain Number 2 Region: 248-262,296-421
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.56e-30
Family ATP-dependent protease Lon (La), catalytic domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378722843|ref|YP_005287729.1|
Sequence length 444
Comment DNA repair protein RadA [Rickettsia rickettsii str. Arizona]
Sequence
MTKKHYICSNCGNISPKWSGQCFDCGVWGSIVEEIISTNQAIVKVGSKQDFDKLSGHVTE
QLRIPTPIGEFNRVLGGGLVLGSAILIGGDPGIGKSTLLLQLAASNFASKMNCLYITGEE
SLDQIKLRAIRLNLTNYNTDILAATNLEDIIASIEANKNNIDLIVIDSIQTITTKELSSP
PGTVSQIRTCANELVNYAKQNNIIILLSCHVTKDGQLAGPKILEHLVDTVLYFEGDHNNH
FRILRSYKNRFGGVGEIGVFEMNGSGLIEVTNPSELFLMQREQNVIGTSIFAGIEGSRPL
LMEVQALIVPSNMVTPRRSAVGWDANRLSMILAVLSSRIGLNLANYEVYLSIAGGLKIAD
PASDLAVTASLISAATGNPVPEHSVFFGEISLSGEIRKTAKAETRIKEAVKLGFNKIICS
KFENLTYDFISSVSHLKDLKEIIK
Download sequence
Identical sequences A0A0H3AXD4 B0BY55 H6PUA0
gi|378722843|ref|YP_005287729.1| gi|379017984|ref|YP_005294219.1| gi|165933398|ref|YP_001650187.1| gi|378721495|ref|YP_005286382.1| gi|379712565|ref|YP_005300904.1| gi|157828679|ref|YP_001494921.1| gi|379019294|ref|YP_005295528.1| gi|378724197|ref|YP_005289081.1| 392021.A1G_04565 452659.RrIowa_0961 gi|379016250|ref|YP_005292485.1| WP_012150986.1.16657 WP_012150986.1.17801 WP_012150986.1.31136 WP_012150986.1.3339 WP_012150986.1.38731 WP_012150986.1.4490 WP_012150986.1.74071 WP_012150986.1.76853 WP_012150986.1.77680 WP_012150986.1.78650 WP_012150986.1.81845 WP_012150986.1.83836 WP_012150986.1.89241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]