SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378722907|ref|YP_005287793.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378722907|ref|YP_005287793.1|
Domain Number 1 Region: 405-570,733-799
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.07e-80
Family Type II DNA topoisomerase 0.00054
Further Details:      
 
Domain Number 2 Region: 13-222
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.2e-70
Family DNA gyrase/MutL, N-terminal domain 0.000000624
Further Details:      
 
Domain Number 3 Region: 231-402
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-53
Family DNA gyrase/MutL, second domain 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378722907|ref|YP_005287793.1|
Sequence length 807
Comment DNA gyrase subunit B [Rickettsia rickettsii str. Arizona]
Sequence
MSEIEKKFNESSYGADSIKVLKGLEAVKKRPGMYIGDVGDGSGLHHMIYEVVDNAIDESL
AGYCDLVRVTLNKNGSVTVSDNGRGIPVEIHEEEGISAAEVIMTQLHAGGKFDQNAYKVA
GGLHGVGVSVVNALSEWLELRIWRNNKEYLMRFNNGITEAPLAVVKENIDKKGTEVTFFP
SVETFTNIEFDFGTIEHRLRELAFLNSGVKILLVDNRFEEVKEVEFYYTGGIEAYVKYID
RAKHAIHPCIVVNTENAESGISLELAMHWNDSYHENILCFTNNIRQRDGGTHLSAFKSAI
TRVITSYLDTTGLNKKAKNYFSGEDTREGLCCVLSVKVPDPKFSSQTKDKLVSSEVRPVV
ENAVYTKVLEWFEEHPAEAKAIIAKIMEAANAREAARKARELTRRKSALEVSNLPGKLAD
CHAKDPAISELFIVEGDSAGGTAKQGRDSKIQAILPLRGKILNVERARFDKMLGSDQIGT
LITALGISVEREFSLEKLRYHKVIIMTDADVDGSHIRTLLLTFFYRHMPALINKGYLYIA
QPPLYKVKKGAAEFYLKNEQALQDYLIKSTINDATLILDDKEQLVGDNLEELINKVVKFN
GLLDHASKKFNRSITEILAINDLLNNKIFDPESDLRLKKALDVLNSLEDSPDKTNWEVLK
HENKIEFFRFSRGLKESKILLKEQLESFEFVQISKLALTIFDIFSKQLKLIVKSQEFDIL
TPSQLLNTIIECGKRGINIQRFKGLGEMNSDQLWETTLDPTKRTLLQVRVAEIDEAEGIF
STLMGDVVEPRRLFIQANALNVVNLDV
Download sequence
Identical sequences A0A0H3AX16 B0BYC7
gi|157828742|ref|YP_001494984.1| gi|379018047|ref|YP_005294282.1| 392021.A1G_04880 452659.RrIowa_1051 WP_012151047.1.31136 WP_012151047.1.3339 WP_012151047.1.38731 WP_012151047.1.4490 WP_012151047.1.74071 WP_012151047.1.77680 WP_012151047.1.78650 WP_012151047.1.81845 WP_012151047.1.83836 WP_012151047.1.89241 gi|378721561|ref|YP_005286448.1| gi|378722907|ref|YP_005287793.1| gi|165933470|ref|YP_001650259.1| gi|378724261|ref|YP_005289145.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]