SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378723290|ref|YP_005288176.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378723290|ref|YP_005288176.1|
Domain Number 1 Region: 222-473
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.76e-85
Family Hsp90 middle domain 0.0000033
Further Details:      
 
Domain Number 2 Region: 3-212
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.07e-64
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000748
Further Details:      
 
Domain Number 3 Region: 503-616
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 9.42e-29
Family HSP90 C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378723290|ref|YP_005288176.1|
Sequence length 621
Comment heat shock protein 90 [Rickettsia rickettsii str. Arizona]
Sequence
MIQEKKKFDAEVGKILNLMIHSLYSNKEIFMRELISNASDACDKLRYLSQSNSELVAGDS
NFKITVKVDKDNGQIIIRDNGIGMNKDDLIENLGTIARSGTANFLKSLSGDSKKDNMLIG
QFGVGFYSSFMVADKVTVTSRKAGEDKVHIWESGGLGEYTVSDSDKEFTRGTEIILHIKK
EEDTFLDHFRLKHIVKSYSDHIAVPIYFFDEAGNNEIQLNSASALWTRPKSEITEEQYKE
FYKSLSYAIDDPWITMHNKNEGAIEFTNLLFIPSSKTFDLFHPDRKRRVKLYIKRVFISD
ENIDLIPSYLRFLRGVVDSEDLPLNISRESLQHNSVLEKIKNAITKRVLGELRKKKEESP
EEYNKFWANFGGALKEGLCEATTNHEKLLEVCIFRSALHNKMISLDEYIANFKEGQSTIY
YLSGDNPDKLLSSPQIEGLLSKKIDVLLFTDTVDDFWVNVNSKYKEHAIKSATRSDIDVE
QTTSQSEAKNTDSKKSDDEYKLLTDYFKETLGELVKEVKISKKLTSSPACLAVSDAAMDI
RMERFLIEQKQIANASAKNLELNPKNKIIEKIFNDLKANNKNNEELVNLIFDQACILEGE
PVADTGAFSKRLNDIVQKAIL
Download sequence
Identical sequences gi|378723290|ref|YP_005288176.1| WP_014362506.1.3339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]