SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378723353|ref|YP_005288239.1| from Rickettsia rickettsii str. Arizona

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378723353|ref|YP_005288239.1|
Domain Number 1 Region: 420-610
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.62e-51
Family DNA mismatch repair protein MutL 0.0073
Further Details:      
 
Domain Number 2 Region: 1-201
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.69e-49
Family DNA gyrase/MutL, N-terminal domain 0.0000196
Further Details:      
 
Domain Number 3 Region: 189-329
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-36
Family DNA gyrase/MutL, second domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|378723353|ref|YP_005288239.1|
Sequence length 610
Comment DNA mismatch repair protein [Rickettsia rickettsii str. Arizona]
Sequence
MTIKFLSESTINRIAAGEVIERPASVVKELVENAVDASSTKIDIILERAGKNLIIISDDG
IGMTDKELEIAVERHTTSKFDESDFLNINTFGFRGEALPSIAAISKMLITSKKRDADKAF
QIKLIGGNEKQVTISVHNEGTKIEIRDLFFATPARLKFLRADKTELAATVGVVKKIALAH
PKISFSLTHDGKNLLKLKGQNKDAETNLKQRIIDVIGDDFIKNAAYIDFKTPDFSICGYT
SSPTYNRASSEDQFLFINNRPVKDKLLQIALRVAYQDYLARDRYPICAIFLQINPQLVDV
NVHPAKAEVRFHDPDYVRNLLIEAIKNALTNKSHVTSTTIASDALELFKNPLVNKQSPVS
KVINVNSKSADYRPTTHSILNTVPQNHVCQKLIDTLSHAKIEQEVENRIEHEQQIRKQYK
LGAAKAQLHTTYIISQTEDSIVITDQHAAHKRLGYEKIKDYLKTEELIKQRLLIPEIVEL
PNEKKADCLYDHREKLYKLGLTLEKFGEKSIIVTEIPNILGDVNVQKLIQDLADHLSDFG
KNIALTELIEHVTETYACHYSIRAGRKLSADEMNALLRQMENTLLSGQCNHGRPTYIELK
LKDIERLFGR
Download sequence
Identical sequences B0BVP7
gi|379018493|ref|YP_005294728.1| gi|165933924|ref|YP_001650713.1| gi|378723353|ref|YP_005288239.1| WP_012262652.1.31136 WP_012262652.1.3339 WP_012262652.1.38731 WP_012262652.1.74071 WP_012262652.1.77680 WP_012262652.1.81845 WP_012262652.1.89241 452659.RrIowa_1592 gi|378724708|ref|YP_005289592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]