SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379016716|ref|YP_005292951.1| from Rickettsia rickettsii str. Brazil

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379016716|ref|YP_005292951.1|
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-43
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00022
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.05e-39
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379016716|ref|YP_005292951.1|
Sequence length 288
Comment UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Rickettsia rickettsii str. Brazil]
Sequence
MQQSTLLKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTDISSENNYIEASYFNVSDT
LLSTTISNDHKVQISTIEHLMAALWGCRIDNAIIKIDGPEVPIMDGSSKPFVFMIECAGK
KLQNAPKKYLKILKDIKVVHKDCELYCTPSDHMTVDLTIDFSSKAIGRQNLSFRDQESFT
KNIADARTFGFIRDVDYLKSKGLAQGASFENAIGIDEQDKILNPNGLRYEDEFVRHKLLD
LFGDLYTNGTSIVSAIKGYKTSHALNNELLHRIFSDTTSYKFVTSSEL
Download sequence
Identical sequences WP_014362310.1.17801 WP_014362310.1.4490 WP_014362310.1.78650 WP_014362310.1.83836 gi|378721020|ref|YP_005285907.1| gi|379016716|ref|YP_005292951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]