SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325978392|ref|YP_004288108.1| from Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325978392|ref|YP_004288108.1|
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily SGNH hydrolase 7.48e-45
Family Acetylhydrolase 0.000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325978392|ref|YP_004288108.1|
Sequence length 218
Comment GDSL family lipase/acylhydrolase [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069]
Sequence
MTDFQELYHKADVQEYRQYILADQQHQLWEKYAALNKAVSHPNIVFAGDSITEYFPIHEL
LTSTVPLYNRGVHGIDSLQFLEHLSSQILDLAPSKVFLLIGVNDLKKRTPEEVCQTIQSI
ITKIHQQLPETQIFLLSVFPMNESPEFVRTPSLRNNQSISLLNDNLSRLAGDKVCWFDVH
DLLCDETGQLKRDWTVDGLHLTVAGYRVIADAIQPYLV
Download sequence
Identical sequences A0A0E1XGI8 F5X197
WP_009854307.1.19369 WP_009854307.1.2742 WP_009854307.1.4451 WP_009854307.1.57133 WP_009854307.1.76930 WP_009854307.1.8633 WP_009854307.1.89533 gi|325978392|ref|YP_004288108.1| gi|386337848|ref|YP_006034017.1| gi|288905403|ref|YP_003430625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]