SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|326804170|ref|YP_004321988.1| from Aerococcus urinae ACS-120-V-Col10a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326804170|ref|YP_004321988.1|
Domain Number 1 Region: 12-141
Classification Level Classification E-value
Superfamily PH domain-like 4e-28
Family BPHL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326804170|ref|YP_004321988.1|
Sequence length 146
Comment hypothetical protein HMPREF9243_1860 [Aerococcus urinae ACS-120-V-Col10a]
Sequence
MAFNLNSLMQGALGNFSQKDQQELTEEYGDFLFKDEEIYSGYQLIRDAIIFTNIRIILVD
KQGASGKKTAFRSLYLSHIVDVEMESAGLAFDDSEITITYLNNIYRRPREEETETVTFEF
PKQTDILPLYRFLGNLVVENRREINQ
Download sequence
Identical sequences F2I7Y8
gi|326804170|ref|YP_004321988.1| WP_013669677.1.64995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]