SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333911102|ref|YP_004484835.1| from Methanotorris igneus Kol 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333911102|ref|YP_004484835.1|
Domain Number 1 Region: 189-444
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.28e-134
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000501
Further Details:      
 
Domain Number 2 Region: 3-188
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.02e-81
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.000000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333911102|ref|YP_004484835.1|
Sequence length 444
Comment methyl-coenzyme M reductase subunit beta [Methanotorris igneus Kol 5]
Sequence
MVKYEDKINLYDAKGNLVEENVPLEAISPLHNPTIQKIVKDIKRTVAVNLAGIENALKTG
AVGGKACIIPGRTLDLPIVENAETIMDYVEKLLRVSPDDDTNLKLINGGKQMAVQLPSKR
LEVAAEYSVSMLNTAMALKEAIIKTFDVDMFDAPMVHAAILGRYPQVPDYMGANIASLLG
APTNLEGLGYALRNIMVNHYVATTKKNIMNAVAFASIMEQTAMFEMGDAIGVFERLHLLG
LAYQGLNADNLVIDLVKANGKNGTVGTVVASVVERALEDGVITEDKKLPSGFVMYKPVDV
AKWNAYAAAGLVAAVIVNCGAARAAQNVASTILYYNDILEYETGLPGVDFGRAEGTAVGF
SFFSHSIYGGGGPGIFHGNHVVTRHSKGFAIPPVCAAMCVDAGTQMFSPEKTSALVGAVY
SAIDEFREPLKYVIEGALEIKDKI
Download sequence
Identical sequences F6BE93
WP_013799369.1.88808 gi|333911102|ref|YP_004484835.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]