SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333911106|ref|YP_004484839.1| from Methanotorris igneus Kol 5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333911106|ref|YP_004484839.1|
Domain Number 1 Region: 273-552
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 8.89e-147
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000952
Further Details:      
 
Domain Number 2 Region: 4-272
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.59e-145
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333911106|ref|YP_004484839.1|
Sequence length 553
Comment methyl-coenzyme M reductase subunit alpha [Methanotorris igneus Kol 5]
Sequence
MEAEKKLFLKALKEKFEEDPKEKYTKFYVFGGWKQSARKREFVEAAEKLLEKRGGIPFYN
PDIGVPLGQRKLMPYKLSGTDYIVEGDDLHFMNNAAMQQMWDDIRRTVIVGMDTAHAVLE
KRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHPALAWDCYAKIFTGDDELADEID
KKFLIDINKLFPEEQAEQIKKAIGKRTYQVNRVPTLVGRVCDGGTIARWSAMQIGMSFIT
AYKLCAGEAAIADFSYAAKHADVIQMGTLLPARRARGPNEPGGIPFGILADIVQTSRVSD
DPVEQALEVVGAGAMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDDFSYYGYDYITKKY
GGCNSIKPTMDVVEDIATEVTLYALEQYDEYPALLEDHFGGSQRAAVTAAAAGITTALAT
GNSNAGLNGWYLSQILHKEYHSRLGFYGYDLQDQCGAANSLSIRNDESSPLELRGPNYPN
YAMNVGHQGEYAGITQAAHSARGDAFALNPLIKVAFADPSLIFDFAHPRKEFARGALREF
EPAGERDPIIPAH
Download sequence
Identical sequences F6BE97
gi|333911106|ref|YP_004484839.1| WP_013799373.1.88808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]