SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|308189950|ref|YP_003922881.1| from Mycoplasma fermentans JER

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|308189950|ref|YP_003922881.1|
Domain Number 1 Region: 160-328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.26e-49
Family G proteins 0.00000687
Further Details:      
 
Domain Number 2 Region: 4-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 4.19e-47
Family Obg GTP-binding protein N-terminal domain 0.0000154
Further Details:      
 
Domain Number 3 Region: 347-419
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 3.01e-20
Family Obg GTP-binding protein C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|308189950|ref|YP_003922881.1|
Sequence length 422
Comment GTP-binding protein [Mycoplasma fermentans JER]
Sequence
MARFIDEIKITLQAGKGGDGMISFRREAHVDKGGPDGGDGGRGGNIYFIGDLGKNTLLNL
YGNKKITAEDGINGGPKNLYGAAGKDTYVKVPLGTVVYKNNKVVADIIEPNKNYLVAQGG
QGGRGNMKFKSPRNTAPRICENGTKGEKFEAHIVLKVMSDVGVVGKPSAGKSTLLSVISN
AKAKIAEYEFTTLVPQLGLVRYFDNSFTVADLPGLIKGASLGKGLGFQFLKHIERCRVIA
HIIDFGLSEKNPIEDYETINNELASYSMHLENKPQIVVANKSDMPDFKDHLKAFKKKYPK
VKVIVISALEQENLDQLKAELWKVIEANKTTPVAEVEEVEMVEIKLEDDFTIANPYRGFF
EVSGPKVEKIYEKIPLISYDNLIRFNNMLKKIGVWDDLIKKGIEPGDTVRILDYEFEWDG
EF
Download sequence
Identical sequences WP_013354638.1.1463 WP_013354638.1.78519 WP_013354638.1.95544 gi|319777231|ref|YP_004136882.1| gi|308189950|ref|YP_003922881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]