SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305665878|ref|YP_003862165.1| from Maribacter sp. HTCC2170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305665878|ref|YP_003862165.1|
Domain Number 1 Region: 13-146
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.85e-44
Family Type II thymidine kinase 0.0000187
Further Details:      
 
Domain Number 2 Region: 147-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000228
Family Type II thymidine kinase zinc finger 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305665878|ref|YP_003862165.1|
Sequence length 214
Comment putative thymidine kinase [Maribacter sp. HTCC2170]
Sequence
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPMVDKRYHEEM
VVSHDANEIRSTPVPAAANIRILADTCDVIGIDEAQFFDDEIVTVCNDLANRGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKAHNDDLVLLGETGEYEP
LSRAAYYKAMLKERVKEIDVDVEEISKAKKDVNG
Download sequence
Identical sequences A4APG3
gi|305665878|ref|YP_003862165.1| WP_013305933.1.69417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]