SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305666334|ref|YP_003862621.1| from Maribacter sp. HTCC2170

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305666334|ref|YP_003862621.1|
Domain Number 1 Region: 28-77
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000298
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305666334|ref|YP_003862621.1|
Sequence length 81
Comment proteinase inhibitor I2, Kunitz metazoa [Maribacter sp. HTCC2170]
Sequence
MTRKKYASLLISIILGISCTDNDDEVAASCLLEPDPGNCLAAIPRYYYDASEQECKEFIW
GGCGGVVPFETLEDCRACEKP
Download sequence
Identical sequences A4AUB2
WP_013306388.1.69417 gi|305666334|ref|YP_003862621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]