SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325954405|ref|YP_004238065.1| from Weeksella virosa DSM 16922

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325954405|ref|YP_004238065.1|
Domain Number 1 Region: 15-106
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 7.06e-19
Family Intron-encoded homing endonucleases 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|325954405|ref|YP_004238065.1|
Domain Number - Region: 146-172
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0376
Family Tetracyclin repressor-like, N-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325954405|ref|YP_004238065.1|
Sequence length 182
Comment phage related endodeoxyribonuclease [Weeksella virosa DSM 16922]
Sequence
MKEVWKDYEDEELATNRSFMVSNSGLVKKIYQGSDRFKIVEGTLNNGYRIIWIVLKDGKR
TAWYVHKMVAETFLENPENKKYVVHLDHNKLNNAVENLQWANHDEWKEHNQHLFRKMKGR
SRLNNLPNSKLTEKQVRSLKKKLANPNKKIKVATLAKQYNISEGQIYRIIRGDNWSHIKI
DS
Download sequence
Identical sequences F0P0S3
gi|325954405|ref|YP_004238065.1| WP_013597878.1.43610 WP_013597878.1.86615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]