SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325955533|ref|YP_004239193.1| from Weeksella virosa DSM 16922

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325955533|ref|YP_004239193.1|
Domain Number 1 Region: 32-235
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.07e-39
Family Endonuclease I 0.001
Further Details:      
 
Domain Number 2 Region: 261-353
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-17
Family Fibronectin type III 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325955533|ref|YP_004239193.1|
Sequence length 591
Comment endonuclease I [Weeksella virosa DSM 16922]
Sequence
MKFKISILASAFAFLLYGQSAPTYYNSVDFNKTKNELKNNLASLITNTHTKVISYSELKD
LLKISDVDPHNSSNLLLIYGSKSHGEHQRSRAIGGSWNREHVYAKSKGTPNLGTTGPGAD
GHHLRPADPKLNSTRGNLSFDDGQGSMAYKTPRGGWFPGDEWKGDVARILMYMYVRYDKR
ALPLNITFAPATYSDDFPDILLKWNVEDPVSDFEIQRNNIVAQTQGNRNPFIDNPYLATV
IWGGPDAQNTWPDTLNGGNTSTDTESPTAPTNLKVTDTQENSISLTWDASVDNVAVNHYE
VYVDGNYRLTVYSTEAKITGLEAGRTYSFYVIAKDAAGNKSENSQTIQAKTNEINGGGNN
NETSCGFEDFSNVVSTGSTPPASSYSDRTWSNNGIVWTATNARTDSQIYIDGVDNKAICM
RKGSLTSSKISGGIGSLSVKTYLPFNDSEGTYTLLINGEEKGQIPYSKNPKTHTISDINV
EGDIVIELVDNKTNNRVSFDNLSWTCYSKLGTNNEVSATSSIVIYPNPVLQNEIFVDGLS
AETSLQIFDVNGRIVQTIDKVKNRTKIRLNNLPKGVYIVKVTNEYKKIIVK
Download sequence
Identical sequences F0P131
WP_013599004.1.86615 gi|325955533|ref|YP_004239193.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]