SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575331|ref|YP_875074.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575331|ref|YP_875074.1|
Domain Number 1 Region: 2-148,269-352
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.15e-50
Family Bacterial dinuclear zinc exopeptidases 0.0044
Further Details:      
 
Domain Number 2 Region: 162-262
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000000000000109
Family Bacterial exopeptidase dimerisation domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575331|ref|YP_875074.1|
Sequence length 360
Comment acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase [Cenarchaeum symbiosum A]
Sequence
MLEKALRLYTPSMAEKPMAEFLADKCDDLGFEDITIDDVGNIIATRGSGPPHVMLCGHMD
VVPGKVRVRRDGDRLYGRGASDAKAPLMAMLFAAAAMPHDGGTVKFVGAVDEEGNATGIK
HLVKQDLDVDYAVFGEPSGLRQVTIAYKGRLAINLRISAEDSSHASAPWLSKNAIEEAML
FCGALREELGTGQEGRSKGMMLTSALTEIKGGTSHNVTPKECEAVMDIRVPVDATCKGVE
ERISKSVKRISRERGIEAFYSILDETDPFEAPHDSPLVRSFNLGVMDVEKCRPTLIRKTG
TGDMNVVGNRLGIPVVTYGPGDPHQAHTINEMVSISEYLSGIEVLKRMLHHLKRLHERKR
Download sequence
Identical sequences A0RTV3
gi|118575331|ref|YP_875074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]