SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575461|ref|YP_875204.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575461|ref|YP_875204.1|
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.11e-40
Family Bacterial dinuclear zinc exopeptidases 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|118575461|ref|YP_875204.1|
Domain Number - Region: 294-343
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00174
Family Bacterial exopeptidase dimerisation domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575461|ref|YP_875204.1|
Sequence length 369
Comment acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase [Cenarchaeum symbiosum A]
Sequence
MKALREVDRGFPGTIDTLQELIRQPSVSAKNEGIEECALLVHRILKRSGITPEILRIKGA
APLVYGEVRSRANPGRTLLFYNHYDVQPAEPLDPWDHPPFGGTVRGNKIFGRGATDDKGE
LVTRIKAVEACLRAEGDVPCNVKFVIEGEEETGSEHIGAYLKKYRKKFACDGVIWEFGYV
DSSDRPVISLGMKGLLYVELSVTGANQDAHSSLAVLIENPAWRLVCALNTMRGPAGTVLI
KDWYREVKPLGKRDVRLVSKEPFDEAAFRREFGIDRFVGGIRGTAAKKALVSGATCNIAG
FHSGYGGEGAKTVLPAKAVAKVDFRLVPGMDPKKQEARLRRHLLSHGFGDISVKVFHGEA
AARTDLGTS
Download sequence
Identical sequences A0RU83
gi|118575461|ref|YP_875204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]