SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575462|ref|YP_875205.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|118575462|ref|YP_875205.1|
Domain Number - Region: 5-50
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000217
Family Bacterial dinuclear zinc exopeptidases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575462|ref|YP_875205.1|
Sequence length 52
Comment hypothetical protein CENSYa_0259 [Cenarchaeum symbiosum A]
Sequence
MHQFSILNAPCVAIGSTHVFSRIHSANEYARTDLLKKTTKCICILLDRFAQD
Download sequence
Identical sequences A0RU84
gi|118575462|ref|YP_875205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]