SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575497|ref|YP_875240.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575497|ref|YP_875240.1|
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000000000206
Family PNP-oxidase like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575497|ref|YP_875240.1|
Sequence length 123
Comment flavin-nucleotide-binding protein [Cenarchaeum symbiosum A]
Sequence
MAGAAENIGQLKYISLETFKKSGEGVKTPVWFVATEGVIYVATGRSTGKAKRIANNPRVR
FAPCTFRGGIKGDWTEGSAEQLSGEEEISIMGLRKKKYGVMSLLSGLAGRSKGGMTVYRI
KED
Download sequence
Identical sequences A0RUB9
gi|118575497|ref|YP_875240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]