SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575518|ref|YP_875261.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575518|ref|YP_875261.1|
Domain Number 1 Region: 7-237
Classification Level Classification E-value
Superfamily Pseudouridine synthase 8.06e-62
Family Pseudouridine synthase II TruB 0.00000291
Further Details:      
 
Domain Number 2 Region: 240-320
Classification Level Classification E-value
Superfamily PUA domain-like 3.04e-17
Family PUA domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118575518|ref|YP_875261.1|
Sequence length 333
Comment pseudouridine synthase [Cenarchaeum symbiosum A]
Sequence
MTLAQLSGLRVIDQDVTDDAHGTYHDKRSVEQLLEYGIVLLDKPPGPTSHEAVAWAKRIL
EIPKAGHSGTLDPQVSGVLPLGLGEATKALGVLLIGPKEYVAVGRFHALQDSEKLGELAR
LFTGPIHQKPPQRSSVLRRTRVKTIHEIEVLEQKERLVLMRVSCEAGTYIRKLLYDMGEV
VGSGASMIELRRTRVDHFTEGSGLVTMHELAEAYAVWKEGDGSRLQRIIRPVEEALAGIK
AVVIRDSAVDALCHGAQLAIPGILQVSDNLRIGDLAGVYTQKGEVVALAEAEMEAEVIAD
ATKGHAFKTKRLIMKTDTYPKSWHSKGTYKEKE
Download sequence
Identical sequences A0RUE0
gi|118575518|ref|YP_875261.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]