SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575525|ref|YP_875268.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575525|ref|YP_875268.1|
Domain Number 1 Region: 64-133
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.77e-17
Family Ribosomal S5 protein, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 146-216
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-16
Family Translational machinery components 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118575525|ref|YP_875268.1|
Sequence length 219
Comment 30S ribosomal protein S5 [Cenarchaeum symbiosum A]
Sequence
MSHPQSRPGGRDGRPRRRREPREEAPWVPKTALGKRVNAGEITSLEEIQEAGARIQESGI
IKKLLPDLKTEVVDVGIIQKMTSNGQSTRFKAIVAAGNENGYLGIGQGKAKQMRIAIEKA
NNQALLNVGPIKLGCGSWECRCDQKHSVPFKVRGKGGSVVIEILPAPRGLGLVAGGKIRR
LLELAGLKDAYTTAKGSTPTTNSTSKAVLECLRQTFSQG
Download sequence
Identical sequences A0RUE7
gi|118575525|ref|YP_875268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]