SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575709|ref|YP_875452.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575709|ref|YP_875452.1|
Domain Number 1 Region: 16-186,250-386
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.9e-44
Family tRNA pseudouridine synthase TruD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118575709|ref|YP_875452.1|
Sequence length 395
Comment tRNA pseudouridine synthase D [Cenarchaeum symbiosum A]
Sequence
MEKPAAAAPAIDAKVGISGYSTIFPGTGGRIRERHEDFEVSEVLTDAALNKIGSGGYAVY
ILKKRGMDTSHALRRAAKAGLRLKALGLKDAAAVTEQYVCSMRKGPAKAWSSGTISLSHA
GYVERPLSGKDMAGNRFSIRITGTHGDASEFDGYNSIPNHYGYQRFGSARPVSHLIGRAI
VKGDFDWAVDLLLSHPSEYDSTEKAELRRSLGDREKLAGKMGDIPPGMDLERTAAAELVR
HGDARRALAALPSSMAGFFVQAYQSYIFNKTLSGTDELQPAEGDVCYTKGLLGRYSDGTG
QYLAIPTVGYAYFRKTRFDGPVSGILKEEGVRPADFGVKELPKAAAEGGFRQAVIGCSDA
RSGPDRAEFTLSRGSYATMVMREIIKPSDPIASGF
Download sequence
Identical sequences A0RUY1
gi|118575709|ref|YP_875452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]