SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118575977|ref|YP_875720.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118575977|ref|YP_875720.1|
Domain Number 1 Region: 96-254
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.31e-46
Family DNA gyrase/MutL, second domain 0.00000766
Further Details:      
 
Weak hits

Sequence:  gi|118575977|ref|YP_875720.1|
Domain Number - Region: 37-91
Classification Level Classification E-value
Superfamily S13-like H2TH domain 0.0004
Family Topoisomerase VI-B subunit middle domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118575977|ref|YP_875720.1|
Sequence length 297
Comment DNA topoisomerase VI, subunit B [Cenarchaeum symbiosum A]
Sequence
MGAGGSNLTYWDAEKSEQVTIELDLDDARHKQLAGAAMGETLTTFLTKRFQRVGPGTAAK
FAGFAGLKPERRLGSMANQELVKLSESLQKFTDFLPPDPTCLAPLGAGPLEKGMLKFFEP
DFAAVVQRPASAYSGFPFVVEMGVAYGGGISVKGPKVYRFANRIPLLYDEGSDVVLKVAG
DMDWRRYSVGHDPPLVIVSHICSTRIPYKTVGKENVADRPEIEREIRLGMQFILRKLSSY
MKKKGRSEMAQKRANLYSKYIPLIAQFCTELAGRPKEPDYSGLITGVSEEGKVEEKV
Download sequence
Identical sequences A0RVP9
gi|118575977|ref|YP_875720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]