SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118576660|ref|YP_876403.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576660|ref|YP_876403.1|
Domain Number 1 Region: 71-175
Classification Level Classification E-value
Superfamily Cupredoxins 0.000000000000048
Family Plastocyanin/azurin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118576660|ref|YP_876403.1|
Sequence length 178
Comment hypothetical protein CENSYa_1477 [Cenarchaeum symbiosum A]
Sequence
MQEPREEVCAQLAELGGISSRTAPVDSGGPGALQYGHTHRQSRGTPVPVNCAQGGFLDFL
ILQHSASNPHVTENDTDIHILKDARLNPCGGCFDKVVAARGLHIAWPNDSPLWHNLASGS
PGSESFSPGKGPDGAFETGIIVPGETYSLDTGGLDRGHYGYYCIIHPWMQGWLEVREP
Download sequence
Identical sequences A0RXN2
gi|118576660|ref|YP_876403.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]