SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118576719|ref|YP_876462.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576719|ref|YP_876462.1|
Domain Number 1 Region: 12-181
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-44
Family Ribonuclease PH domain 1-like 0.0000086
Further Details:      
 
Domain Number 2 Region: 155-238
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.97e-26
Family Ribonuclease PH domain 2-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|118576719|ref|YP_876462.1|
Sequence length 243
Comment RNase PH [Cenarchaeum symbiosum A]
Sequence
MGGRDTDVVLLDENGIRCDGRKISETRRVEITAGVLNNANGSAYIEFGDNKILAGIFGPR
DVHPKHMVRTETGILRCRYHMSPFSVSERKKPAPSRREIEISKVIKEALEPSLMLEQFPR
TAVDVFIEVLQADGGSRCAALAAASVALADAGIPMRDMVSACAAGKVADTIVLDVNNEED
QAGQADMPVGYMPNLDQVTLIQLDGVLTPDEYSRCAAMAIDGCKQVYEVQKKALSDRFFG
GGE
Download sequence
Identical sequences A0RXU1
gi|118576719|ref|YP_876462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]