SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118576766|ref|YP_876509.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576766|ref|YP_876509.1|
Domain Number 1 Region: 191-302
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000712
Family Integrin A (or I) domain 0.064
Further Details:      
 
Weak hits

Sequence:  gi|118576766|ref|YP_876509.1|
Domain Number - Region: 330-388
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 0.0698
Family Tetrapyrrole methylase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118576766|ref|YP_876509.1|
Sequence length 437
Comment uncharacterized protein with a von Willebrand factor type A (vWA) domain [Cenarchaeum symbiosum A]
Sequence
MLGAQALKERSVPVEDLESIMRGKLGAPAGADVQQDGQSGGQDAADGKQGTEEPGADAAD
DAESGPDAGESAGGAAYTEMLREAGYLRDSKNWLTRKAFLEIGDRMLRDVMSRLGAGEGG
LHGTVRPGEGSILSDGTRMIEPGGDAGNLCVPQTVLNAVLRLSREGPVGFPLELERQDLE
EFESLDDVRTAVAYCIDLSSTMKTKLQDGTSRIEAAKRALWVLYMLNSRFFPDDPVFVVG
FASLASEVDPRDIPFLRTYDANDGLLHYTNYQAALGLARRLLRRSGAQNRRIVLITDGQP
SACFVGDEAQKAEIISVKPYSTFYSPQREVIGRIKEERNLRLDADPDRLVYLCYRYKKID
QIIERRTAAEAAACSREGVAVDSIVVSDEDELLEYVARLERQMGGRSYHVRRGDMDRVLV
ADYVSGLRKVFTKRHSW
Download sequence
Identical sequences A0RXY8
gi|118576766|ref|YP_876509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]