SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118576838|ref|YP_876581.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118576838|ref|YP_876581.1|
Domain Number 1 Region: 118-269
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.32e-21
Family Aromatic dioxygenase reductase-like 0.038
Further Details:      
 
Domain Number 2 Region: 3-107
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 4.05e-19
Family Ferredoxin reductase FAD-binding domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118576838|ref|YP_876581.1|
Sequence length 279
Comment Na -transporting NADH ubiquinone oxidoreductase subunit [Cenarchaeum symbiosum A]
Sequence
MVTDVPARITYIELLREDLVIIRLVPEGRDMPEYQTGQFLTLGMGIPSENHKLVRRAYSI
ASHPGNRKYFEFVIRWVRKPLPGRVTTELFYASEGDTVQMGMPTGNALTIDYKLPDGRPD
NRRIICVGGGTGIAPFVAFADHLRSTGDKREIIVLHGASYVDELSYKSHFTGLEYDSADS
NDWNFKYRAAISRPKERFNRSWSGHTGRVESFFKPGKEGRSPLEELVGEEITPENTMIYI
CGYQGTIDGVMEHVEKKGFVTLHDKKEDGSYAVKYESYG
Download sequence
Identical sequences A0RY60
gi|118576838|ref|YP_876581.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]