SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118577193|ref|YP_876936.1| from Cenarchaeum symbiosum A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|118577193|ref|YP_876936.1|
Domain Number - Region: 78-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00798
Family DNA-binding protein Mj223 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|118577193|ref|YP_876936.1|
Sequence length 208
Comment hypothetical protein CENSYa_2029 [Cenarchaeum symbiosum A]
Sequence
MLNIAQLDRLINQRNGEMILSAEKIDIYDTLFMILSANGDGENSRTLLQKITYFCSNSII
NIENMAFKPQYHGPYSAKVNVALEKMVSCGFLERVTIYGFNGKSNYRLTDDGKELANDAK
GKYGKEYDKICSVVKTCHNEAEPKGTEPEDTKLSYAAKIHYISREHKTDSPDKISKYSKR
YDWAMDASFIDKHFSLAMELDTGCKNNS
Download sequence
Identical sequences A0RZ65
gi|118577193|ref|YP_876936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]