SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378723987|ref|YP_005288871.1| from Rickettsia rickettsii str. Hauke

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378723987|ref|YP_005288871.1|
Domain Number 1 Region: 319-475
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.27e-26
Family Histidine kinase 0.00064
Further Details:      
 
Domain Number 2 Region: 255-326
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000255
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378723987|ref|YP_005288871.1|
Sequence length 476
Comment osmolarity sensor protein EnvZ [Rickettsia rickettsii str. Hauke]
Sequence
MHFISKLLQHISKSFRQDEFKSEPTQRIKIREHRRILKNSLVSSSLKYALPRTLFVRFMF
IIIIPILIGQIVAIFLFYDRHWYNVSYYTSTIIINEIESLIKEHRNNSREITHLSENYLN
LSYQFQLNKKLSIKQPKLGEPLTIFKNILATKIHEKNIVKLNKENKIEVFLELKDGVLYI
TFPAKLLLNPTVYIFVLWIISLTVILLSVSIIFSKNQIKSILTLADSMDKFGRGVLKGKN
FKPSGALEIRKAGLAFLKMKARIEKQITKKTTMLAMISHDLRTPLTRMKLQLELMEESEE
IEGLKQDILTMQQMINSYLDFAKGESTEEFEDILLLPWMERFFNKWSHVNIEFIKSTNLD
KLEVCIKPHSFERALSNLIGNAIKYGTKIKISSKDNSSTVAIIIEDNGPGIDDTETHLVF
KPFYRSDKARQLDNASNVGLGLAITKEIINDHKGSIYLEDSKDLGGLSVRIEIPKI
Download sequence
Identical sequences A0A0H3AWD2
gi|378723987|ref|YP_005288871.1| gi|379019067|ref|YP_005295301.1| gi|157828463|ref|YP_001494705.1| gi|379017776|ref|YP_005294011.1| gi|378722632|ref|YP_005287518.1| gi|378721281|ref|YP_005286168.1| 392021.A1G_03330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]