SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378724323|ref|YP_005289207.1| from Rickettsia rickettsii str. Hauke

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378724323|ref|YP_005289207.1|
Domain Number 1 Region: 446-587
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-25
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 345-442
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000667
Family Homodimeric domain of signal transducing histidine kinase 0.0032
Further Details:      
 
Domain Number 3 Region: 309-358
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000051
Family HAMP domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378724323|ref|YP_005289207.1|
Sequence length 599
Comment nitrogen regulation protein [Rickettsia rickettsii str. Hauke]
Sequence
MLSYLKQNLHSYFSSRVLIFTLATAAIIFACATFYVISLESKNFSTIIGFLLVDLAIFLI
LGVLLTQKFFTKNNNNDSSKLQNRIVIAFSLVAAIPTIIVSVFSVYFFNLSVQAWFDKKI
STVLDQSVIVAESYIAEHKLQLKETALAVAEDLSDMYYDLIHNPALFTKTLNTEAEMRSL
DEAIVLNKSTNTIVANSYLSFSLSFATIPAHLIKKADLGELVEVKSDPTKIRMLIKLKEY
NDVYLLVGRLVDNKIIDHVDATNGAAAEYNSLKNEIDNIQIKFSIMFIFIALLLLFVAIS
FGVIFTAKIVKPIKKLVTATDNVKDGDLTVQVPENEVDKDEIGTLYVAFNRMIKQLSRQQ
RDLVIAQRAMAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKERVEFENYLKMIIR
HTNDIKNIVSEFVLFARLPAPKFTKSELVYLVKHIVEARKLLNDNILYKFESNVEQFDFM
CDATQINQVMINLLKNAEESIEGRESGKIEVTIDVKDDFISVIVMDNGKGFPPELIGKAT
ESYVTTSSKGMGVGLAIVKRIVEEHCGILDIANRTAEGAIIDIKFDLKELDLKAKRLEM
Download sequence
Identical sequences A0A0H3AX95 B0BUK0 H6PUM5
gi|379019419|ref|YP_005295653.1| gi|378724323|ref|YP_005289207.1| gi|378721622|ref|YP_005286509.1| gi|165933527|ref|YP_001650316.1| gi|378722969|ref|YP_005287855.1| 392021.A1G_05210 452659.RrIowa_1124 gi|157828801|ref|YP_001495043.1| gi|379018108|ref|YP_005294343.1| gi|379712690|ref|YP_005301029.1| WP_012151102.1.16657 WP_012151102.1.17801 WP_012151102.1.31136 WP_012151102.1.3339 WP_012151102.1.38731 WP_012151102.1.4490 WP_012151102.1.74071 WP_012151102.1.76853 WP_012151102.1.77680 WP_012151102.1.78650 WP_012151102.1.81845 WP_012151102.1.83836 WP_012151102.1.89241 gi|379016132|ref|YP_005292367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]