SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|198284866|ref|YP_002221187.1| from Acidithiobacillus ferrooxidans ATCC 53993

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|198284866|ref|YP_002221187.1|
Domain Number 1 Region: 285-452,587-680,757-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.13e-21
Family ABC transporter ATPase domain-like 0.049
Further Details:      
 
Domain Number 2 Region: 54-256
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000000216
Family PHP domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|198284866|ref|YP_002221187.1|
Sequence length 894
Comment hypothetical protein Lferr_2794 [Acidithiobacillus ferrooxidans ATCC 53993]
Sequence
MQSKKTRSQAINEALKQPNGARFYRCALQVNPFAYHDRHAKQTAFQNEADYNSAIIEACH
ANNIEAIAVTDHYRISDSRGLINAARAAGIFAFGGFEAASDDGVHFLCLYDPDKDDSLER
LIGQMGVGDHKAISPNGDKNCLKLLECVRKQGGISIAAHVAADNGLLATLEGQPRMNAWQ
SRDLYACALPGPIGDAPQNVRAILENKDAAHKRERRVAVINASDVNSPEDLAEPRSSCFI
KMSALSVEGLRQAFLDPESRIRLHSDPSPEPHAEFIAMAWEGGFLDGTRLHFNGNLNVLV
GGRGTGKSTIIESLRYALAIDPIGEEANKAHQGVLKYVLKSGTKISLLVRSHHPAKHDYT
IERTIPNPPVVKDELGNVLNLSPLDVAPSVEIFGQHEISELTKSRGKLTLLLERFVERDP
NAGAQKAKLRLDLERSRGRITDVQREIKLIEERLSLLPSLEETQKRFQDAGLEERLKEKS
LLVREERILATIKERLAPVSTLRQELAGLLPIDTAFLSAKALEGLPNSALLIEGAAILDR
MTAQLEAVAGQIEQELSVADTSLSALRGHWDQRRQAVETTYQALLRELQKSKIDGEEFIR
LRRQIEELRPLREKKEALTRDLAAYQQNRRNLLDEWFNLQSAEYRALEKAAKRVSRKLGG
RVRAMVMMGGNREPLEKLLRDEIGGNLAALLERLKSRDTLSLMDFAQCCREGKDSLISNY
SLPSAAAERLAQADPDIFMRMEELELPATTQIELNTSSEGEPETWQTIEALSTGQKATAV
LLLLLLESEAPLVVDQPEDDLDNRFITEGVVPTMRNEKRKRQFVFSTHNANIPVLGDAEL
IIGLSTGIQNEVVQGRVNERHMGSIDMQPVREMVEEILEGGKTAFEMRRQKYGF
Download sequence
Identical sequences B5ER29 B7JB74
WP_012537648.1.13253 WP_012537648.1.28209 WP_012537648.1.49158 WP_012537648.1.50737 WP_012537648.1.90948 243159.AFE_3193 380394.Lferr_2794 gi|218667470|ref|YP_002427549.1| gi|198284866|ref|YP_002221187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]