SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379011007|ref|YP_005268819.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379011007|ref|YP_005268819.1|
Domain Number 1 Region: 89-151
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000112
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379011007|ref|YP_005268819.1|
Sequence length 422
Comment Bsp-like protein [Acetobacterium woodii DSM 1030]
Sequence
MNKRIIVLLLCVFLGIVLIPFDVLAENSPEVISASGTEWGSDLDNIVITIHTNKDVDQII
LNSGQGELILSPETNYSEDDLRGNNEVMDMNGDLEVDRQDYEILKKHVEGGCRDYTSTVR
CSHCGAADINGDGVIDEADLQMVDDHITGKCSLEDCYFHGTRTYREETEDGFTWTFHYTP
TIAGTDTMTLTPQAVTSTGTRSGDVQTVVIKSEEYKNPEILRYGLVPNQNKYLIGSTVTV
YAVTPLETDKVAFTCGSETRETDTWTAIDYDVSEKTWRQSFVVNTVGMTGFTITGYGKQS
NNGFIAGETATFKEQIVDPQVISTNRSVVTHVDTWATSSTDEDGNVTTTVHYHYWYTITV
TATCNGDTDYVVFHTPSGSVSDYSYASSGGNKNFSTSWTSENSGETASANAYATIVVYPS
DF
Download sequence
Identical sequences H6LDF8
WP_014355533.1.36127 gi|379011007|ref|YP_005268819.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]