SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379013281|ref|YP_005271093.1| from Acetobacterium woodii DSM 1030

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379013281|ref|YP_005271093.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.96e-24
Family HD domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379013281|ref|YP_005271093.1|
Sequence length 144
Comment putative metal dependent phosphohydrolase [Acetobacterium woodii DSM 1030]
Sequence
MLNKAIEIAAIAHTGQVDKAGAPYILHPLRVMLSRDNDLERICAVLHDVVEDSEFTFEDL
RKQGFSEEVIEVLDCLTKRDGECYDAFIGRVIENETACRVKLADIADNMDLTRIEKPTEK
DQERIKKYEKAVETILAALSSEIE
Download sequence
Identical sequences H6LC89
WP_014357790.1.36127 gi|379013281|ref|YP_005271093.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]