SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|197105175|ref|YP_002130552.1| from Phenylobacterium zucineum HLK1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197105175|ref|YP_002130552.1|
Domain Number 1 Region: 185-343
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.83e-40
Family GGDEF domain 0.00008
Further Details:      
 
Domain Number 2 Region: 97-180
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000173
Family FCH domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197105175|ref|YP_002130552.1|
Sequence length 349
Comment diguanylate cyclase [Phenylobacterium zucineum HLK1]
Sequence
MSSDVETSLRGPKAYALARKAIEAMEAHQVWPTALNFELWVHYVAAKDSALATEIDHLIE
AGEPFTDAVGEQLAAQFLPKAKLNGEILEAGQTLSKELDSVSRAIESARETSEAYGQQLA
SASESLDGEDAQAIKSMVETLTVATRKVREENHALESQLQDTTAELGRLREHLEQVRRDA
MTDALSGLANRKAFDEALERACDQGEQGGPVTLAVIDIDHFKSFNDTWGHQTGDQVIRYV
ASVIQRCSPAPRVSARYGGEEFAIIFPGESARDSLAVLEAVREEVSSRILKRRSTNEDLG
AITISAGIAERKPGESPASLVERADSALYASKRGGRNRTSCADPIAAAA
Download sequence
Identical sequences B4RBS6
WP_012522265.1.63133 gi|197105175|ref|YP_002130552.1| 450851.PHZ_c1712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]