SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0E11089g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0E11089g
Domain Number 1 Region: 24-297
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.2e-91
Family Inorganic pyrophosphatase 0.00000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0E11089g
Sequence length 297
Comment similar to uniprot|P28239 Saccharomyces cerevisiae YMR267W PPA2 Mitochondrial inorganic pyrophosphatase required for mitochondrial function and possibly involved in energy generation from inorganic pyrophosphate [Kluyveromyces lactis] Complete CDS. KLLA0E11089g
Sequence
MSRDMRRASQHLRLIGNHLHARNYHNVLVGSKYSSSFKQYLQLPNGEIGSYFHDVPLDLD
VDAKTCNMIVEVPRWSNGKFEISKTEPFNPITQDIKKGKPRFVNNIFPYHGYIHNYGAIP
QTWEQPLIEVLPGFKGDNDPLDCCEIGSSIAKMGDIKKVKLLGSLALIDDGELDWKVICI
DIEDPIAIKLNKLADVDTVMPGLLDATRTWFRDYKIPAGKQPNVFAFEGEYQDQASTLST
VQECHEAWNALVRGEIKADGSEAEIPSIVRAGTHIRVEPNQQNDTPIPQEVDKWYYV
Download sequence
Identical sequences Q6CNP0
28985.Q6CNP0 gnl|GLV|KLLA0E11089g XP_454449.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]