SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0E12739g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0E12739g
Domain Number 1 Region: 278-320,353-434
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.79e-35
Family Eukaryotic type KH-domain (KH-domain type I) 0.00088
Further Details:      
 
Domain Number 2 Region: 184-276
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.43e-25
Family Cold shock DNA-binding domain-like 0.0000603
Further Details:      
 
Domain Number 3 Region: 131-183
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000000471
Family ECR1 N-terminal domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0E12739g
Sequence length 437
Comment similar to uniprot|P38792 Saccharomyces cerevisiae YHR069C RRP4 Ribosomal RNA Processing 3->5 exoribonuclease Component of the exosome 3->5 exonuclease complex with Rrp41p Rrp42p Rrp43p and Dis3p (Rrp44p). [Kluyveromyces lactis] Complete CDS. KLLA0E12739g
Sequence
MEQNSVLSLHQIKRCLTVDLCCNIFTSFTTLISSHLIALLFNLENFQLTNTKSNKGTARK
SAHRTPSAVPDIVISLLGTMSDVISVINRNEFWSNGRLEQDEYESDSSSGSEQEHDIEMS
GAHDSNGGIDHQDGSIVTPGELITDDPIWMKGHGTYFLENKTYSSVVGTVSRVNRLLSVL
PLKSRYIPETGDHIVGRITDVGNRRWKVDIGAKQYAVLMLGSVNLPGGVLRRKSETDELQ
MRNFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGTFVQVPSSLIVRSKNHTHNLP
GNVTIILGVNGFVWIRKSSKMDLSGKTTTTGSGQSDHLPGSNNAMSVSITRLEEESSWEI
YSDKNDTVTVSVRQTITRYANVIKALAHCELGITEPRIISAYEASMAYGNLGQLIESETM
ESLGQDVINSEKMRGAA
Download sequence
Identical sequences Q6CNG5
28985.Q6CNG5 XP_454524.1.35115 gnl|GLV|KLLA0E12739g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]