SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0E17667g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0E17667g
Domain Number 1 Region: 43-323
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.49e-112
Family Inorganic pyrophosphatase 0.00000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0E17667g
Sequence length 327
Comment highly similar to uniprot|P00817 Saccharomyces cerevisiae YBR011C IPP1 Cytoplasmic inorganic pyrophosphatase (PPase) catalyzes the rapid exchange of oxygens from Pi with water highly expressed and essential for viability active-site residues show identity to those from E. coli PPase [Kluyveromyces lactis] Complete CDS. KLLA0E17667g
Sequence
MKNACTGLPLATDAIYMILGSSIDIQPYIPPAKRIYTPDTMSYTTRQVGAKNSLDYKVYI
EKDGKPISAFHDIPLYADEANGIFNMVVEIPRWTNAKLEITKEEPLNPIIQDTKKGKLRF
VRNCFPHHGYIHNYGAFPQTWEDPNESHPETKAVGDNDPLDVLEIGEQVAYTGQVKQVKV
LGVMALLDEGETDWKVIAIDINDPLAPKLNDIEDVEKHLPGLLRATNEWFRIYKIPDGKP
ENQFAFSGEAKNKKYTLDVIRECNEAWKKLISGKSADAKKIDLTNTTLSDTATYSAEAAS
AVPAANVLPDEPIDKSIDKWFFISGSA
Download sequence
Identical sequences XP_454746.1.35115 gnl|GLV|KLLA0E17667g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]