SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gnl|GLV|KLLA0F00462g from Kluyveromyces lactis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gnl|GLV|KLLA0F00462g
Domain Number 1 Region: 256-395
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.2e-50
Family P-domain of calnexin/calreticulin 0.00000555
Further Details:      
 
Domain Number 2 Region: 52-272
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-36
Family Calnexin/calreticulin 0.0000448
Further Details:      
 
Domain Number 3 Region: 399-443
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000823
Family Calnexin/calreticulin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gnl|GLV|KLLA0F00462g
Sequence length 628
Comment some similarities with uniprot|P27825 Saccharomyces cerevisiae YAL058W CNE1 [Kluyveromyces lactis] Complete CDS. KLLA0F00462g
Sequence
MNPLLLLSQIGFGTLAVAINPMVKGDYRIEHPNMTDLSDLQSKLSSDSYFESFQYSSHDE
FIHNWVISELEMEHVDETMSRAFPGLWKLESPYLVPGFSNDLALVLGSSQTRSAIAHKLD
HEISVKTKEKLVVQYEVKLQKMLECGGAYMKLLKTNADDLSQYDHSADDYVLVFGPDSCS
MYTNEVHFILKRENPISEEFEDKYLTEAPLSGLDQPITRLYTLILDSADQSFEIRIDGEV
VKAGNLLAEGTFRPSLNPPREIEDPSASQPADWGSRSMIPDPTAIKPEDWDENEPKWIPD
PMFKKPEEWDDSISEYIEDESRSKPDWWNDKVDGRWIAPLIVNPSCYTKQGCGKWRPKMV
ENEKYRGTWKAEMIPNPNYQGEWKAPLIANPNYYEDKTPANIDAITAISFDIWSSASDIS
FDNIYVGKSIEEAELVGNSTFLPKLSLEKKELEVVMEKAHSEDVNEVDTSEESSKKTPYK
NVVDKENHLDYLKLIDEKIKSCKTLQTFIAWFLQVDDLYKGFLISAFMVVVVSISCMGML
KFLMWSQGIDLSSSSNASRKPKKIENETSDGPSANTVTEIAASTGYSTPSSKVISQRTIQ
LQGDSDFDEELEISIVEESGSASDSEDK
Download sequence
Identical sequences Q6CLT9
gnl|GLV|KLLA0F00462g 28985.Q6CLT9 XP_455100.1.35115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]