SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10004681m|PACid:20199598 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10004681m|PACid:20199598
Domain Number 1 Region: 66-296
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.92e-85
Family Inorganic pyrophosphatase 0.000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10004681m|PACid:20199598
Sequence length 300
Sequence
MAATRVITTAASSASQTTSCLFTKRPFLLPTQKVCGFNGLCFNKRALVVKSKRPFSCNAI
YNPQVQTTQEGQSETLDYRVFFQDGSGKKVSPWHDIPLHLGDGVFHFIVEIPKESSAKME
VATDEAFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPTQANSEVEGAFGDNDPVDVV
EIGESQRKIGEVLKVKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPGTL
TAIRDWFRDYKIPDGKPANRFGLGNKPANKDYALKIIHETNESWAKLVKRSVSPGDLSLF
Download sequence
Identical sequences V4KVN2
XP_006394147.1.70970 Thhalv10004681m|PACid:20199598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]