SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10008767m|PACid:20187619 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10008767m|PACid:20187619
Domain Number 1 Region: 28-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 8.77e-71
Family Inorganic pyrophosphatase 0.00000349
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10008767m|PACid:20187619
Sequence length 212
Sequence
MSEETKEDQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK
VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA
RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV
AVNDFLPSESAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences V4LAD1
Thhalv10008767m|PACid:20187619 XP_006418370.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]