SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10010704m|PACid:20207652 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10010704m|PACid:20207652
Domain Number 1 Region: 33-215
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.75e-69
Family Inorganic pyrophosphatase 0.00000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10010704m|PACid:20207652
Sequence length 219
Sequence
MAPPIEVATKTYVEKQRTGSALPPLNERILSSMTQRSVAAHPWHDLEIGPEAPIIFNCVV
EIGKGSKVKYELDKTTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPIDVLVIMQEPVI
PGCFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYK
KNENKEVAVNDFLPATAAYEAVQHSMDLYADYVMETLRR
Download sequence
Identical sequences V4NG74
XP_006403668.1.70970 Thhalv10010704m|PACid:20207652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]